PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN26262.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 395aa    MW: 43230.5 Da    PI: 8.0832
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN26262.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.65.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT +Ed++l+ +++++G+g+W+t +++ g+ R++k+c++rw++yl
       KHN26262.1 14 KGAWTVQEDQKLIAYIQKHGTGSWRTLPQKAGLQRCGKSCRLRWFNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.52.3e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ ++eE++ ++++ + lG++ W++Ia++++ +Rt++++k++w++yl
       KHN26262.1  67 RGKLSQEEEQTIIKLQAVLGNR-WSSIAKHLP-KRTDNEIKNYWNSYL 112
                      7999******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129418.101961IPR017930Myb domain
SuperFamilySSF466898.61E-2912108IPR009057Homeodomain-like
SMARTSM007172.1E-121363IPR001005SANT/Myb domain
PfamPF002492.9E-161461IPR001005SANT/Myb domain
CDDcd001671.42E-101661No hitNo description
PROSITE profilePS5129425.80562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-2465115IPR009057Homeodomain-like
SMARTSM007171.4E-1566114IPR001005SANT/Myb domain
PfamPF002494.3E-1567112IPR001005SANT/Myb domain
CDDcd001673.01E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MGRSPCCSHE ELRKGAWTVQ EDQKLIAYIQ KHGTGSWRTL PQKAGLQRCG KSCRLRWFNY  60
LRPDIKRGKL SQEEEQTIIK LQAVLGNRWS SIAKHLPKRT DNEIKNYWNS YLRKQFEKNA  120
GDSSSPKPIS SDSSPESKSN DMCMVPLEKT DCHEPNTNQS HQHKLSKSTS SSTHLLNKVA  180
SKILASGYLE AIKSCQPVVA GNSKSEGVVK SGIGPQKDNI RDPLVPNLTS PSHSVTSAKL  240
LNKMATSLPH KVYGLEAVKA VFSKLMESSE KGGIATSDGS SFVGSDQVGS CLNALSPFED  300
GPHISKIIDS PSSPTLMFNQ VTTPSCFSED NEDNWQCVSS NYVSFRNCAA SGGGGDCSVS  360
EINLGESSSS TSCFLFENAD LGTCDDEIRK YIQYL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29111174109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311890.0KT031189.1 Glycine max clone HN_CCL_77 MYB/HD-like transcription factor (Glyma04g33210.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003528196.10.0PREDICTED: transcription factor MYB51
TrEMBLA0A0B2R3390.0A0A0B2R339_GLYSO; Transcription factor MYB29
TrEMBLI1KCU70.0I1KCU7_SOYBN; Uncharacterized protein
STRINGGLYMA06G21040.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1699968
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.12e-62myb domain protein 16
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]